SCOPe 2.08: Domain d2v63i_: 2v63 I:

Lineage for d2v63i_ (2v63 I:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families)

5. Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)

6. Protein automated matches [190066] (7 species)
   not a true protein

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [186785] (9 PDB entries)

8. Domain d2v63i_: 2v63 I: [152609]
   Other proteins in same PDB: d2v63a1, d2v63a2, d2v63b1, d2v63b2, d2v63c1, d2v63c2, d2v63d1, d2v63d2, d2v63e1, d2v63e2, d2v63f1, d2v63f2, d2v63g1, d2v63g2, d2v63h1, d2v63h2
   automated match to d1ir21_
   complexed with cap, edo, mg; mutant

Details for d2v63i_

PDB Entry: 2v63, 1.8 Å

PDB Description: Crystal structure of Rubisco from Chlamydomonas reinhardtii with a large-subunit V331A mutation

PDB Compounds: (I:) ribulose bisphosphate carboxylase small chain 1

SCOPe Domain Sequences for d2v63i_:

Sequence; same for both SEQRES and ATOM records:

>d2v63i_ d.73.1.1 (I:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
flvqrpktardfqpankrsv

Timeline for d2v63i_:

• d2v63i_ first appeared in SCOP 1.75, called d2v63i1
  
• d2v63i_ appears in SCOPe 2.07