Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily) duplication: composed of two very similar alpha+beta folds |
Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) |
Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins) |
Protein Aminopeptidase P, C-terminal domain [55928] (2 species) |
Species Escherichia coli [TaxId:562] [55929] (20 PDB entries) |
Domain d2v3ya2: 2v3y A:177-440 [152480] Other proteins in same PDB: d2v3ya1 automatically matched to d1a16a2 complexed with cl, mn |
PDB Entry: 2v3y (more details), 1.6 Å
SCOPe Domain Sequences for d2v3ya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v3ya2 d.127.1.1 (A:177-440) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]} speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl gldvadvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn enltasvvkkpeeiealmvaarkq
Timeline for d2v3ya2: