SCOPe 2.05: Domain d2uzdd1: 2uzd D:175-309

Lineage for d2uzdd1 (2uzd D:175-309)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (75 PDB entries)
   Uniprot P20248 175-432

8. Domain d2uzdd1: 2uzd D:175-309 [152341]
   Other proteins in same PDB: d2uzda_, d2uzdc_
   automated match to d1h1pb1
   complexed with c85

Details for d2uzdd1

PDB Entry: 2uzd, 2.72 Å

PDB Description: crystal structure of human cdk2 complexed with a thiazolidinone inhibitor

PDB Compounds: (D:) cyclin a2

SCOPe Domain Sequences for d2uzdd1:

Sequence; same for both SEQRES and ATOM records:

>d2uzdd1 a.74.1.1 (D:175-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
ehlvlkvltfdlaap

Timeline for d2uzdd1:

• d2uzdd1 first appeared in SCOP 1.75
  
• d2uzdd1 appears in SCOPe 2.04
  
• d2uzdd1 appears in SCOPe 2.06
  
• d2uzdd1 appears in the current release, SCOPe 2.08