Lineage for d2uzab5 (2uza B:669-785)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1203811Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) (S)
  5. 1203940Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (13 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 1204017Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain V [54889] (1 species)
  7. 1204018Species Desulfovibrio africanus [TaxId:873] [54890] (10 PDB entries)
  8. 1204030Domain d2uzab5: 2uza B:669-785 [152334]
    Other proteins in same PDB: d2uzaa1, d2uzaa2, d2uzaa3, d2uzaa4, d2uzab1, d2uzab2, d2uzab3, d2uzab4
    automatically matched to d1b0pa5
    complexed with ca, co2, htl, mg, sf4

Details for d2uzab5

PDB Entry: 2uza (more details), 2.42 Å

PDB Description: crystal structure of the free radical intermediate of pyruvate:ferredoxin oxidoreductase from desulfovibrio africanus
PDB Compounds: (B:) pyruvate ferredoxin oxidoreductase

SCOPe Domain Sequences for d2uzab5:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uzab5 d.58.1.5 (B:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]}
tsqfekrgvainvpqwvpenciqcnqcafvcphsailpvlakeeelvgapanftaleakg
kelkgykfriqintldcmgcgncadicppkekalvmqpldtqrdaqvpnleyaarip

SCOPe Domain Coordinates for d2uzab5:

Click to download the PDB-style file with coordinates for d2uzab5.
(The format of our PDB-style files is described here.)

Timeline for d2uzab5: