Lineage for d2ux0b_ (2ux0 B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1640316Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1640820Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1641226Family d.17.4.7: Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89851] (2 proteins)
    automatically mapped to Pfam PF13474
    automatically mapped to Pfam PF08332
  6. 1641247Protein automated matches [190404] (1 species)
    not a true protein
  7. 1641248Species Human (Homo sapiens) [TaxId:9606] [187282] (2 PDB entries)
  8. 1641249Domain d2ux0b_: 2ux0 B: [152232]
    Other proteins in same PDB: d2ux0a1
    automated match to d1hkxa_
    complexed with gly

Details for d2ux0b_

PDB Entry: 2ux0 (more details), 2.46 Å

PDB Description: structure of the oligomerisation domain of calcium-calmodulin dependent protein kinase ii gamma
PDB Compounds: (B:) calcium-calmodulin dependent protein kinase (cam kinase) II gamma

SCOPe Domain Sequences for d2ux0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ux0b_ d.17.4.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smtededlkvrkqeiikiteqlieainngdfeaytkicdpgltsfepealgnlvegmdfh
kfyfenllsknskpihttilnphvhvigedaaciayirltqyidgqgrprtsqseetrvw
hrrdgkwlnvhyhcsg

SCOPe Domain Coordinates for d2ux0b_:

Click to download the PDB-style file with coordinates for d2ux0b_.
(The format of our PDB-style files is described here.)

Timeline for d2ux0b_: