Lineage for d2ux0a1 (2ux0 A:387-521)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1895674Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1896198Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1896612Family d.17.4.7: Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89851] (2 proteins)
    automatically mapped to Pfam PF13474
    automatically mapped to Pfam PF08332
  6. 1896613Protein Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89852] (3 species)
  7. 1896614Species Human (Homo sapiens) [TaxId:9606] [159962] (1 PDB entry)
    Uniprot Q8N4I3 387-521
  8. 1896615Domain d2ux0a1: 2ux0 A:387-521 [152231]
    Other proteins in same PDB: d2ux0b_, d2ux0c_, d2ux0d_, d2ux0e_, d2ux0f_
    complexed with gly

Details for d2ux0a1

PDB Entry: 2ux0 (more details), 2.46 Å

PDB Description: structure of the oligomerisation domain of calcium-calmodulin dependent protein kinase ii gamma
PDB Compounds: (A:) calcium-calmodulin dependent protein kinase (cam kinase) II gamma

SCOPe Domain Sequences for d2ux0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ux0a1 d.17.4.7 (A:387-521) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Human (Homo sapiens) [TaxId: 9606]}
tededlkvrkqeiikiteqlieainngdfeaytkicdpgltsfepealgnlvegmdfhkf
yfenllsknskpihttilnphvhvigedaaciayirltqyidgqgrprtsqseetrvwhr
rdgkwlnvhyhcsga

SCOPe Domain Coordinates for d2ux0a1:

Click to download the PDB-style file with coordinates for d2ux0a1.
(The format of our PDB-style files is described here.)

Timeline for d2ux0a1: