| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
| Family d.17.4.7: Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89851] (2 proteins) automatically mapped to Pfam PF13474 automatically mapped to Pfam PF08332 |
| Protein Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89852] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [159962] (1 PDB entry) Uniprot Q8N4I3 387-521 |
| Domain d2ux0a1: 2ux0 A:387-521 [152231] Other proteins in same PDB: d2ux0b_, d2ux0c_, d2ux0d_, d2ux0e_, d2ux0f_ complexed with gly |
PDB Entry: 2ux0 (more details), 2.46 Å
SCOPe Domain Sequences for d2ux0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ux0a1 d.17.4.7 (A:387-521) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Human (Homo sapiens) [TaxId: 9606]}
tededlkvrkqeiikiteqlieainngdfeaytkicdpgltsfepealgnlvegmdfhkf
yfenllsknskpihttilnphvhvigedaaciayirltqyidgqgrprtsqseetrvwhr
rdgkwlnvhyhcsga
Timeline for d2ux0a1: