SCOPe 2.05: Domain d2ux0f_: 2ux0 F:

Lineage for d2ux0f_ (2ux0 F:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.7: Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89851] (2 proteins)
   automatically mapped to Pfam PF13474
   automatically mapped to Pfam PF08332

6. Protein automated matches [190404] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187282] (2 PDB entries)

8. Domain d2ux0f_: 2ux0 F: [152236]
   Other proteins in same PDB: d2ux0a1
   automated match to d1hkxa_
   complexed with gly

Details for d2ux0f_

PDB Entry: 2ux0, 2.46 Å

PDB Description: structure of the oligomerisation domain of calcium-calmodulin dependent protein kinase ii gamma

PDB Compounds: (F:) calcium-calmodulin dependent protein kinase (cam kinase) II gamma

SCOPe Domain Sequences for d2ux0f_:

Sequence; same for both SEQRES and ATOM records:

>d2ux0f_ d.17.4.7 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tededlkvrkqeiikiteqlieainngdfeaytkicdpgltsfepealgnlvegmdfhkf
yfenllsknskpihttilnphvhvigedaaciayirltqyidgqgrprtsqseetrvwhr
rdgkwlnvhyhcsg

Timeline for d2ux0f_:

• d2ux0f_ first appeared in SCOP 1.75, called d2ux0f1
  
• d2ux0f_ appears in SCOPe 2.04
  
• d2ux0f_ appears in SCOPe 2.06
  
• d2ux0f_ appears in the current release, SCOPe 2.08