Lineage for d2uuoa2 (2uuo A:298-437)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 838806Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest
  4. 838807Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (2 families) (S)
  5. 838808Family c.59.1.1: MurCDEF C-terminal domain [53245] (4 proteins)
  6. 838825Protein UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD [53246] (1 species)
  7. 838826Species Escherichia coli [TaxId:562] [53247] (11 PDB entries)
  8. 838836Domain d2uuoa2: 2uuo A:298-437 [152198]
    Other proteins in same PDB: d2uuoa1, d2uuoa3
    automatically matched to d1e0da2
    complexed with lk3, so4

Details for d2uuoa2

PDB Entry: 2uuo (more details), 2.5 Å

PDB Description: crystal structure of murd ligase in complex with d-glu containing sulfonamide inhibitor
PDB Compounds: (A:) udp-n-acetylmuramoylalanine--d-glutamate ligase

SCOP Domain Sequences for d2uuoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uuoa2 c.59.1.1 (A:298-437) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]}
glphrfevvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplar
ylngdnvrlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasld
qfknfeqrgnefarlakelg

SCOP Domain Coordinates for d2uuoa2:

Click to download the PDB-style file with coordinates for d2uuoa2.
(The format of our PDB-style files is described here.)

Timeline for d2uuoa2: