Lineage for d1e0da2 (1e0d A:298-437)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 838806Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest
  4. 838807Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (2 families) (S)
  5. 838808Family c.59.1.1: MurCDEF C-terminal domain [53245] (4 proteins)
  6. 838825Protein UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD [53246] (1 species)
  7. 838826Species Escherichia coli [TaxId:562] [53247] (11 PDB entries)
  8. 838837Domain d1e0da2: 1e0d A:298-437 [33956]
    Other proteins in same PDB: d1e0da1, d1e0da3
    complexed with so4

Details for d1e0da2

PDB Entry: 1e0d (more details), 2.4 Å

PDB Description: udp-n-acetylmuramoyl-l-alanine:d-glutamate ligase
PDB Compounds: (A:) udp-n-acetylmuramoylalanine--d-glutamate ligase

SCOP Domain Sequences for d1e0da2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e0da2 c.59.1.1 (A:298-437) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]}
glphrfevvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplar
ylngdnvrlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasld
qfknfeqrgnefarlakelg

SCOP Domain Coordinates for d1e0da2:

Click to download the PDB-style file with coordinates for d1e0da2.
(The format of our PDB-style files is described here.)

Timeline for d1e0da2: