SCOPe 2.06: Domain d2roda2: 2rod A:152-308

Lineage for d2roda2 (2rod A:152-308)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein EAT/MCL-1 (Myeloid cell leukemia sequence 1) [118212] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [118213] (5 PDB entries)
   Uniprot P97287 152-308

8. Domain d2roda2: 2rod A:152-308 [152177]
   Other proteins in same PDB: d2roda3
   automated match to d2roda1

Details for d2roda2

PDB Entry: 2rod

PDB Description: solution structure of mcl-1 complexed with noxaa

PDB Compounds: (A:) Induced myeloid leukemia cell differentiation protein Mcl-1 homolog

SCOPe Domain Sequences for d2roda2:

Sequence; same for both SEQRES and ATOM records:

>d2roda2 f.1.4.1 (A:152-308) EAT/MCL-1 (Myeloid cell leukemia sequence 1) {Mouse (Mus musculus) [TaxId: 10090]}
eddlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhetafqg
mlrkldiknegdvksfsrvmvhvfkdgvtnwgrivtlisfgafvakhlksvnqesfiepl
aetitdvlvrtkrdwlvkqrgwdgfveffhvqdlegg

Timeline for d2roda2:

• d2roda2 first appeared in SCOP 1.75, called d2roda1
  
• d2roda2 was called d2roda_ in SCOPe 2.05
  
• d2roda2 appears in SCOPe 2.07
  
• d2roda2 appears in the current release, SCOPe 2.08