Lineage for d2rl0k1 (2rl0 K:153-197)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1704451Fold g.27: FnI-like domain [57602] (1 superfamily)
    disulfide-rich, all-beta
  4. 1704452Superfamily g.27.1: FnI-like domain [57603] (3 families) (S)
  5. 1704453Family g.27.1.1: Fibronectin type I module [57604] (2 proteins)
    automatically mapped to Pfam PF00039
  6. 1704454Protein Fibronectin [57605] (1 species)
  7. 1704455Species Human (Homo sapiens) [TaxId:9606] [57606] (12 PDB entries)
  8. 1704490Domain d2rl0k1: 2rl0 K:153-197 [152138]
    automatically matched to d1fbra1

Details for d2rl0k1

PDB Entry: 2rl0 (more details), 2 Å

PDB Description: Crystal structure of the fourth and fifth fibronectin F1 modules in complex with a fragment of staphylococcus aureus fnbpa-5
PDB Compounds: (K:) Fibronectin

SCOPe Domain Sequences for d2rl0k1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rl0k1 g.27.1.1 (K:153-197) Fibronectin {Human (Homo sapiens) [TaxId: 9606]}
ekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsr

SCOPe Domain Coordinates for d2rl0k1:

Click to download the PDB-style file with coordinates for d2rl0k1.
(The format of our PDB-style files is described here.)

Timeline for d2rl0k1: