Lineage for d2rl0a1 (2rl0 A:153-197)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1462729Fold g.27: FnI-like domain [57602] (1 superfamily)
    disulfide-rich, all-beta
  4. 1462730Superfamily g.27.1: FnI-like domain [57603] (2 families) (S)
  5. 1462731Family g.27.1.1: Fibronectin type I module [57604] (2 proteins)
    automatically mapped to Pfam PF00039
  6. 1462732Protein Fibronectin [57605] (1 species)
  7. 1462733Species Human (Homo sapiens) [TaxId:9606] [57606] (13 PDB entries)
  8. 1462758Domain d2rl0a1: 2rl0 A:153-197 [152128]
    automatically matched to d1fbra1

Details for d2rl0a1

PDB Entry: 2rl0 (more details), 2 Å

PDB Description: Crystal structure of the fourth and fifth fibronectin F1 modules in complex with a fragment of staphylococcus aureus fnbpa-5
PDB Compounds: (A:) Fibronectin

SCOPe Domain Sequences for d2rl0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rl0a1 g.27.1.1 (A:153-197) Fibronectin {Human (Homo sapiens) [TaxId: 9606]}
ekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsr

SCOPe Domain Coordinates for d2rl0a1:

Click to download the PDB-style file with coordinates for d2rl0a1.
(The format of our PDB-style files is described here.)

Timeline for d2rl0a1: