PDB entry 2rl0
View 2rl0 on RCSB PDB site
Description: Crystal structure of the fourth and fifth fibronectin F1 modules in complex with a fragment of staphylococcus aureus fnbpa-5
Class: cell adhesion
Keywords: FIBRONECTIN, 4F15F1, BETA ZIPPER, STAPHYLOCOCCUS AUREUS, Acute phase, Alternative splicing, Cell adhesion, Extracellular matrix, Glycoprotein, Heparin-binding, Phosphorylation, Pyrrolidone carboxylic acid, Secreted, Sulfation, Cell wall, Peptidoglycan-anchor, Virulence
Deposited on
2007-10-18, released
2008-08-05
The last revision prior to the SCOPe 2.03 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.221
AEROSPACI score: 0.41
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Fibronectin
Species: Homo sapiens [TaxId:9606]
Gene: FN1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d2rl0a1, d2rl0a2 - Chain 'B':
Compound: Fibronectin
Species: Homo sapiens [TaxId:9606]
Gene: FN1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d2rl0b1, d2rl0b2 - Chain 'C':
Compound: Fibronectin-binding protein
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: Fibronectin
Species: Homo sapiens [TaxId:9606]
Gene: FN1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d2rl0d1, d2rl0d2 - Chain 'E':
Compound: Fibronectin-binding protein
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'F':
Compound: Fibronectin
Species: Homo sapiens [TaxId:9606]
Gene: FN1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d2rl0f1, d2rl0f2 - Chain 'G':
Compound: Fibronectin-binding protein
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'H':
Compound: Fibronectin-binding protein
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'I':
Compound: Fibronectin
Species: Homo sapiens [TaxId:9606]
Gene: FN1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d2rl0i1, d2rl0i2 - Chain 'J':
Compound: Fibronectin-binding protein
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'K':
Compound: Fibronectin
Species: Homo sapiens [TaxId:9606]
Gene: FN1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d2rl0k1, d2rl0k2 - Chain 'L':
Compound: Fibronectin-binding protein
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2rl0A (A:)
ekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsrnrcndqdtrtsyrig
dtwskkdnrgnllqcictgngrgewkcer
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2rl0B (B:)
ekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsrnrcndqdtrtsyrig
dtwskkdnrgnllqcictgngrgewkcer
- Chain 'C':
No sequence available.
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>2rl0D (D:)
ekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsrnrcndqdtrtsyrig
dtwskkdnrgnllqcictgngrgewkcer
- Chain 'E':
No sequence available.
- Chain 'F':
Sequence, based on SEQRES records: (download)
>2rl0F (F:)
ekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsrnrcndqdtrtsyrig
dtwskkdnrgnllqcictgngrgewkcer
Sequence, based on observed residues (ATOM records): (download)
>2rl0F (F:)
ekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsrnrcndqdtrtsyrig
dtwskkdrgnllqcictgngrgewkcer
- Chain 'G':
No sequence available.
- Chain 'H':
No sequence available.
- Chain 'I':
Sequence, based on SEQRES records: (download)
>2rl0I (I:)
ekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsrnrcndqdtrtsyrig
dtwskkdnrgnllqcictgngrgewkcer
Sequence, based on observed residues (ATOM records): (download)
>2rl0I (I:)
ekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsrnrcndqdtrtsyrig
dtwsqcictgngrgewkce
- Chain 'J':
No sequence available.
- Chain 'K':
Sequence; same for both SEQRES and ATOM records: (download)
>2rl0K (K:)
ekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsrnrcndqdtrtsyrig
dtwskkdnrgnllqcictgngrgewkcer
- Chain 'L':
No sequence available.