PDB entry 2rl0

View 2rl0 on RCSB PDB site
Description: Crystal structure of the fourth and fifth fibronectin F1 modules in complex with a fragment of staphylococcus aureus fnbpa-5
Class: cell adhesion
Keywords: FIBRONECTIN, 4F15F1, BETA ZIPPER, STAPHYLOCOCCUS AUREUS, Acute phase, Alternative splicing, Cell adhesion, Extracellular matrix, Glycoprotein, Heparin-binding, Phosphorylation, Pyrrolidone carboxylic acid, Secreted, Sulfation, Cell wall, Peptidoglycan-anchor, Virulence
Deposited on 2007-10-18, released 2008-08-05
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.221
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibronectin
    Species: Homo sapiens [TaxId:9606]
    Gene: FN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2rl0a1, d2rl0a2
  • Chain 'B':
    Compound: Fibronectin
    Species: Homo sapiens [TaxId:9606]
    Gene: FN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2rl0b1, d2rl0b2
  • Chain 'C':
    Compound: Fibronectin-binding protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Fibronectin
    Species: Homo sapiens [TaxId:9606]
    Gene: FN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2rl0d1, d2rl0d2
  • Chain 'E':
    Compound: Fibronectin-binding protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Fibronectin
    Species: Homo sapiens [TaxId:9606]
    Gene: FN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2rl0f1, d2rl0f2
  • Chain 'G':
    Compound: Fibronectin-binding protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Fibronectin-binding protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Fibronectin
    Species: Homo sapiens [TaxId:9606]
    Gene: FN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2rl0i1, d2rl0i2
  • Chain 'J':
    Compound: Fibronectin-binding protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Fibronectin
    Species: Homo sapiens [TaxId:9606]
    Gene: FN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2rl0k1, d2rl0k2
  • Chain 'L':
    Compound: Fibronectin-binding protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rl0A (A:)
    ekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsrnrcndqdtrtsyrig
    dtwskkdnrgnllqcictgngrgewkcer
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rl0B (B:)
    ekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsrnrcndqdtrtsyrig
    dtwskkdnrgnllqcictgngrgewkcer
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rl0D (D:)
    ekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsrnrcndqdtrtsyrig
    dtwskkdnrgnllqcictgngrgewkcer
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2rl0F (F:)
    ekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsrnrcndqdtrtsyrig
    dtwskkdnrgnllqcictgngrgewkcer
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rl0F (F:)
    ekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsrnrcndqdtrtsyrig
    dtwskkdrgnllqcictgngrgewkcer
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2rl0I (I:)
    ekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsrnrcndqdtrtsyrig
    dtwskkdnrgnllqcictgngrgewkcer
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rl0I (I:)
    ekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsrnrcndqdtrtsyrig
    dtwsqcictgngrgewkce
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rl0K (K:)
    ekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsrnrcndqdtrtsyrig
    dtwskkdnrgnllqcictgngrgewkcer
    

  • Chain 'L':
    No sequence available.