SCOPe 2.07: Domain d2rkya1: 2rky A:152-197

Lineage for d2rkya1 (2rky A:152-197)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.27: FnI-like domain [57602] (1 superfamily)
   disulfide-rich, all-beta

4. Superfamily g.27.1: FnI-like domain [57603] (3 families)

5. Family g.27.1.1: Fibronectin type I module [57604] (2 proteins)
   automatically mapped to Pfam PF00039

6. Protein Fibronectin [57605] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57606] (12 PDB entries)

8. Domain d2rkya1: 2rky A:152-197 [152112]
   automatically matched to d1fbra1
   complexed with k, scn

Details for d2rkya1

PDB Entry: 2rky, 1.8 Å

PDB Description: crystal structure of the fourth and fifth fibronectin f1 modules in complex with a fragment of staphylococcus aureus fnbpa-1

PDB Compounds: (A:) Fibronectin

SCOPe Domain Sequences for d2rkya1:

Sequence; same for both SEQRES and ATOM records:

>d2rkya1 g.27.1.1 (A:152-197) Fibronectin {Human (Homo sapiens) [TaxId: 9606]}
aekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsr

Timeline for d2rkya1:

• d2rkya1 first appeared in SCOP 1.75
  
• d2rkya1 appears in SCOPe 2.06
  
• d2rkya1 appears in the current release, SCOPe 2.08