![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
![]() | Superfamily d.37.1: CBS-domain pair [54631] (2 families) ![]() |
![]() | Family d.37.1.1: CBS-domain pair [54632] (21 proteins) Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain |
![]() | Protein Uncharacterized protein PAE2072 [160178] (1 species) 2 CBS domains = 1 Bateman domain; binds two adenosine nucleotides per subunit (one per one CBS repeat) |
![]() | Species Pyrobaculum aerophilum [TaxId:13773] [160179] (2 PDB entries) Uniprot Q8ZVX8 2-132 |
![]() | Domain d2rifa1: 2rif A:2-132 [152089] complexed with amp, cs |
PDB Entry: 2rif (more details), 2.35 Å
SCOPe Domain Sequences for d2rifa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rifa1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} irtsellkrppvslpetatirevatelaknrvglavltardnpkrpvavvserdilrava qrldldgpampianspitvldtdpvhvaaekmrrhnirhvvvvnkngelvgvlsirdlcf eraillelata
Timeline for d2rifa1: