SCOP 1.75: Domain d2rica1: 2ric A:235-355

Lineage for d2rica1 (2ric A:235-355)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (8 families)

5. Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
   Pfam PF00059

6. Protein Surfactant protein, lectin domain [56461] (2 species)

7. Species Human (Homo sapiens), SP-D [TaxId:9606] [56462] (14 PDB entries)

8. Domain d2rica1: 2ric A:235-355 [152071]
   Other proteins in same PDB: d2rica2, d2ricb2, d2ricc2
   automatically matched to d1b08a1
   complexed with ca, gmh

Details for d2rica1

PDB Entry: 2ric, 1.8 Å

PDB Description: crystal structure of the trimeric neck and carbohydrate recognition domain of human surfactant protein d in complex with l-glycero-d- manno-heptopyranosyl-(1-3)-l-glycero-d-manno-heptopyranose

PDB Compounds: (A:) Pulmonary surfactant-associated protein D

SCOP Domain Sequences for d2rica1:

Sequence; same for both SEQRES and ATOM records:

>d2rica1 d.169.1.1 (A:235-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D [TaxId: 9606]}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f

Timeline for d2rica1:

• d2rica1 is new in SCOP 1.75
  
• d2rica1 appears in SCOPe 2.01
  
• d2rica1 appears in the current release, SCOPe 2.08