![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (8 families) ![]() |
![]() | Family d.169.1.1: C-type lectin domain [56437] (28 proteins) Pfam PF00059 |
![]() | Protein Surfactant protein, lectin domain [56461] (2 species) |
![]() | Species Human (Homo sapiens), SP-D [TaxId:9606] [56462] (14 PDB entries) |
![]() | Domain d2ricb1: 2ric B:235-355 [152073] Other proteins in same PDB: d2rica2, d2ricb2, d2ricc2 automatically matched to d1b08a1 complexed with ca, gmh |
PDB Entry: 2ric (more details), 1.8 Å
SCOP Domain Sequences for d2ricb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ricb1 d.169.1.1 (B:235-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D [TaxId: 9606]} pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce f
Timeline for d2ricb1:
![]() Domains from other chains: (mouse over for more information) d2rica1, d2rica2, d2ricc1, d2ricc2 |