Lineage for d2ribc1 (2rib C:235-355)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1682071Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1682072Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1682776Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 1682777Protein automated matches [190159] (12 species)
    not a true protein
  7. 1682825Species Human (Homo sapiens) [TaxId:9606] [186882] (61 PDB entries)
  8. 1682889Domain d2ribc1: 2rib C:235-355 [152069]
    Other proteins in same PDB: d2riba2, d2ribb2, d2ribc2
    complexed with ca, gmh

Details for d2ribc1

PDB Entry: 2rib (more details), 1.8 Å

PDB Description: crystal structure of the trimeric neck and carbohydrate recognition domain of human surfactant protein d in complex with l-glycero-d- manno-heptose
PDB Compounds: (C:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d2ribc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ribc1 d.169.1.0 (C:235-355) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f

SCOPe Domain Coordinates for d2ribc1:

Click to download the PDB-style file with coordinates for d2ribc1.
(The format of our PDB-style files is described here.)

Timeline for d2ribc1: