|  | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) | 
|  | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold | 
|  | Superfamily d.169.1: C-type lectin-like [56436] (9 families)  | 
|  | Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 | 
|  | Protein Surfactant protein, lectin domain [56461] (2 species) | 
|  | Species Human (Homo sapiens), SP-D [TaxId:9606] [56462] (14 PDB entries) | 
|  | Domain d2ribc1: 2rib C:235-355 [152069] Other proteins in same PDB: d2riba2, d2ribb2, d2ribc2 automatically matched to d1b08a1 complexed with ca, gmh | 
PDB Entry: 2rib (more details), 1.8 Å
SCOPe Domain Sequences for d2ribc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ribc1 d.169.1.1 (C:235-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D [TaxId: 9606]}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f
Timeline for d2ribc1:
|  View in 3D Domains from other chains: (mouse over for more information) d2riba1, d2riba2, d2ribb1, d2ribb2 |