Lineage for d2ribc1 (2rib C:235-355)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1226319Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1226320Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1226321Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1226673Protein Surfactant protein, lectin domain [56461] (2 species)
  7. 1226674Species Human (Homo sapiens), SP-D [TaxId:9606] [56462] (14 PDB entries)
  8. 1226695Domain d2ribc1: 2rib C:235-355 [152069]
    Other proteins in same PDB: d2riba2, d2ribb2, d2ribc2
    automatically matched to d1b08a1
    complexed with ca, gmh

Details for d2ribc1

PDB Entry: 2rib (more details), 1.8 Å

PDB Description: crystal structure of the trimeric neck and carbohydrate recognition domain of human surfactant protein d in complex with l-glycero-d- manno-heptose
PDB Compounds: (C:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d2ribc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ribc1 d.169.1.1 (C:235-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D [TaxId: 9606]}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f

SCOPe Domain Coordinates for d2ribc1:

Click to download the PDB-style file with coordinates for d2ribc1.
(The format of our PDB-style files is described here.)

Timeline for d2ribc1: