| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily) 5 helices; folded leaf |
Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) ![]() this domain interrupts the G-protein common fold |
| Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein) |
| Protein Transducin (alpha subunit), insertion domain [47897] (4 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [140674] (4 PDB entries) Uniprot P21279 67-183! Uniprot P27600 82-203! Uniprot P27601 76-201 |
| Domain d2rgna1: 2rgn A:67-183 [152012] Other proteins in same PDB: d2rgna2, d2rgnc1, d2rgnd2, d2rgnf1 automatically matched to d2bcjq1 complexed with alf, gdp, mg |
PDB Entry: 2rgn (more details), 3.5 Å
SCOPe Domain Sequences for d2rgna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rgna1 a.66.1.1 (A:67-183) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]}
ysdedkrgftklvyqniftamqamiramdtlkipykyehnkahaqlvrevdvekvsafen
pyvdaikslwndpgiqecydrrreyqlsdstkyylndldrvadpsylptqqdvlrvr
Timeline for d2rgna1:
View in 3DDomains from other chains: (mouse over for more information) d2rgnc1, d2rgnd1, d2rgnd2, d2rgnf1 |