Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.265: Pseudouridine synthase [100877] (1 superfamily) consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold |
Superfamily d.265.1: Pseudouridine synthase [55120] (5 families) the active site is the most conserved structural region of the superfamily and is located between the subdomains |
Family d.265.1.2: Pseudouridine synthase II TruB [69746] (2 proteins) contains C-terminal PUA domain |
Domain d2rfka2: 2rfk A:8-252 [151997] Other proteins in same PDB: d2rfka1, d2rfkb_, d2rfkc_ automated match to d2ey4a2 protein/RNA complex; complexed with zn |
PDB Entry: 2rfk (more details), 2.87 Å
SCOPe Domain Sequences for d2rfka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rfka2 d.265.1.2 (A:8-252) automated matches {Pyrococcus furiosus [TaxId: 2261]} evrrilpadikrevlikdenaetnpdwgfppekrpiemhiqfgvinldkppgptshevva wikkilnlekaghggtlapkvsgvlpvalekatrvvqallpagkeyvalmhlhgdvpedk iiqvmkefegeiiqrpplrsavkrrlrtrkvyyievleiegrdvlfrvgveagtyirsli hhiglalgvgahmselrrtrsgpfkedetlitlhdlvdyyyfwkedgieeyfrkaiqpme kaveh
Timeline for d2rfka2: