SCOPe 2.08: Domain d2rfka2: 2rfk A:8-252

Lineage for d2rfka2 (2rfk A:8-252)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
   consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold

4. Superfamily d.265.1: Pseudouridine synthase [55120] (5 families)
   the active site is the most conserved structural region of the superfamily and is located between the subdomains

5. Family d.265.1.2: Pseudouridine synthase II TruB [69746] (2 proteins)
   contains C-terminal PUA domain

6. Protein automated matches [254626] (1 species)
   not a true protein
7. Species Pyrococcus furiosus [TaxId:2261] [255582] (1 PDB entry)

8. Domain d2rfka2: 2rfk A:8-252 [151997]
   Other proteins in same PDB: d2rfka1, d2rfkb_, d2rfkc_
   automated match to d2ey4a2
   protein/RNA complex; complexed with zn

Details for d2rfka2

PDB Entry: 2rfk, 2.87 Å

PDB Description: substrate rna positioning in the archaeal h/aca ribonucleoprotein complex

PDB Compounds: (A:) Probable tRNA pseudouridine synthase B

SCOPe Domain Sequences for d2rfka2:

Sequence; same for both SEQRES and ATOM records:

>d2rfka2 d.265.1.2 (A:8-252) automated matches {Pyrococcus furiosus [TaxId: 2261]}
evrrilpadikrevlikdenaetnpdwgfppekrpiemhiqfgvinldkppgptshevva
wikkilnlekaghggtlapkvsgvlpvalekatrvvqallpagkeyvalmhlhgdvpedk
iiqvmkefegeiiqrpplrsavkrrlrtrkvyyievleiegrdvlfrvgveagtyirsli
hhiglalgvgahmselrrtrsgpfkedetlitlhdlvdyyyfwkedgieeyfrkaiqpme
kaveh

Timeline for d2rfka2:

• d2rfka2 first appeared in SCOP 1.75
  
• d2rfka2 appears in SCOPe 2.07