Lineage for d2rfka2 (2rfk A:8-252)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2615008Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 2615009Superfamily d.265.1: Pseudouridine synthase [55120] (5 families) (S)
    the active site is the most conserved structural region of the superfamily and is located between the subdomains
  5. 2615024Family d.265.1.2: Pseudouridine synthase II TruB [69746] (2 proteins)
    contains C-terminal PUA domain
  6. Protein automated matches [254626] (1 species)
    not a true protein
  7. Species Pyrococcus furiosus [TaxId:2261] [255582] (1 PDB entry)
  8. 2615052Domain d2rfka2: 2rfk A:8-252 [151997]
    Other proteins in same PDB: d2rfka1, d2rfkb_, d2rfkc_
    automated match to d2ey4a2
    protein/RNA complex; complexed with zn

Details for d2rfka2

PDB Entry: 2rfk (more details), 2.87 Å

PDB Description: substrate rna positioning in the archaeal h/aca ribonucleoprotein complex
PDB Compounds: (A:) Probable tRNA pseudouridine synthase B

SCOPe Domain Sequences for d2rfka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rfka2 d.265.1.2 (A:8-252) automated matches {Pyrococcus furiosus [TaxId: 2261]}
evrrilpadikrevlikdenaetnpdwgfppekrpiemhiqfgvinldkppgptshevva
wikkilnlekaghggtlapkvsgvlpvalekatrvvqallpagkeyvalmhlhgdvpedk
iiqvmkefegeiiqrpplrsavkrrlrtrkvyyievleiegrdvlfrvgveagtyirsli
hhiglalgvgahmselrrtrsgpfkedetlitlhdlvdyyyfwkedgieeyfrkaiqpme
kaveh

SCOPe Domain Coordinates for d2rfka2:

Click to download the PDB-style file with coordinates for d2rfka2.
(The format of our PDB-style files is described here.)

Timeline for d2rfka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2rfka1