Class a: All alpha proteins [46456] (289 folds) |
Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold |
Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) duplication: contains multiple CxxCH motifs |
Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins) the main characteristic feature of this motif is the packing of its two hemes many members contains one or more complete motifs flanked by incomplete motifs and/or other domains |
Protein automated matches [190276] (11 species) not a true protein |
Species Escherichia coli [TaxId:562] [187218] (2 PDB entries) |
Domain d2rdzc_: 2rdz C: [151969] automated match to d1gu6a_ complexed with ca, edo, hec, so4 |
PDB Entry: 2rdz (more details), 1.74 Å
SCOPe Domain Sequences for d2rdzc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rdzc_ a.138.1.3 (C:) automated matches {Escherichia coli [TaxId: 562]} tveaknetfapqhpdqylswkatseqservdalaedprlvilwagypfsrdynkprghaf avtdvretlrtgapknaedgplpmacwsckspdvarliqkdgedgyfhgkwarggpeivn nlgcadchntaspefakgkpeltlsrpyaarameaigkpfekagrfdqqsmvcgqchvey yfdgknkavkfpwddgmkvenmeqyydkiafsdwtnslsktpmlkaqhpeyetwtagihg knnvtcidchmpkvqnaegklytdhkignpfdnfaqtcanchtqdkaalqkvvaerkqsi ndlkikvedqlvhahfeakaaldagateaemkpiqddirhaqwrwdlaiashgihmhape eglrmlgtamdkaadartklarllatkgitheiqipdistkekaqqaiglnmeqikaekq dfiktvipqweeqarknglls
Timeline for d2rdzc_: