Lineage for d2rdoh2 (2rdo H:1-58)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208184Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
    beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha
  4. 2208185Superfamily d.100.1: L9 N-domain-like [55658] (3 families) (S)
  5. 2208186Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein)
    automatically mapped to Pfam PF01281
  6. 2208187Protein Ribosomal protein L9 N-domain [55660] (3 species)
  7. 2208195Species Escherichia coli [TaxId:562] [160581] (29 PDB entries)
    Uniprot P0A7R1 1-58
  8. 2208220Domain d2rdoh2: 2rdo H:1-58 [151947]
    Other proteins in same PDB: d2rdo01, d2rdo11, d2rdo31, d2rdo41, d2rdo81, d2rdoc1, d2rdoc2, d2rdod1, d2rdoe1, d2rdof1, d2rdog1, d2rdog2, d2rdoh1, d2rdoi1, d2rdoi2, d2rdoj1, d2rdok1, d2rdol1, d2rdom1, d2rdon1, d2rdoo1, d2rdop1, d2rdoq1, d2rdor1, d2rdos1, d2rdot1, d2rdou1, d2rdov1, d2rdow1, d2rdox1, d2rdoy1, d2rdoz1
    automatically matched to 2AW4 H:1-58

Details for d2rdoh2

PDB Entry: 2rdo (more details), 9.1 Å

PDB Description: 50s subunit with ef-g(gdpnp) and rrf bound
PDB Compounds: (H:) 50S ribosomal protein L9

SCOPe Domain Sequences for d2rdoh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rdoh2 d.100.1.1 (H:1-58) Ribosomal protein L9 N-domain {Escherichia coli [TaxId: 562]}
mqvilldkvanlgslgdqvnvkagyarnflvpqgkavpatkknieffearraeleakl

SCOPe Domain Coordinates for d2rdoh2:

Click to download the PDB-style file with coordinates for d2rdoh2.
(The format of our PDB-style files is described here.)

Timeline for d2rdoh2: