Lineage for d2rceh_ (2rce H:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404159Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)
  6. 2404299Protein Stress sensor protease DegS, catalytic domain [110236] (1 species)
  7. 2404300Species Escherichia coli [TaxId:562] [110237] (12 PDB entries)
    Uniprot P31137 37-354 ! Uniprot P31137
  8. 2404328Domain d2rceh_: 2rce H: [151883]
    automated match to d3lgib_

Details for d2rceh_

PDB Entry: 2rce (more details), 2.35 Å

PDB Description: dfp modified degs delta pdz
PDB Compounds: (H:) Protease degS

SCOPe Domain Sequences for d2rceh_:

Sequence, based on SEQRES records: (download)

>d2rceh_ b.47.1.1 (H:) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]}
detpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvind
adqiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaign
pynlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsf
dksndgetpegigfaipfqlatkimdklird

Sequence, based on observed residues (ATOM records): (download)

>d2rceh_ b.47.1.1 (H:) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]}
detpasynlavrraapavvnvynrtlgsgvimdqrgyiitnkhvindadqiivalqdgrv
feallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignpynlgqtitqgii
satgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfdtpegigfaipfq
latkimdklird

SCOPe Domain Coordinates for d2rceh_:

Click to download the PDB-style file with coordinates for d2rceh_.
(The format of our PDB-style files is described here.)

Timeline for d2rceh_: