Class a: All alpha proteins [46456] (289 folds) |
Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) |
Family a.93.1.1: CCP-like [48114] (5 proteins) |
Protein Cytochrome c peroxidase, CCP [48119] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (198 PDB entries) Uniprot P00431 |
Domain d2rbvx_: 2rbv X: [151859] automated match to d1ac4a_ complexed with 278, hem, po4 |
PDB Entry: 2rbv (more details), 1.39 Å
SCOPe Domain Sequences for d2rbvx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rbvx_ a.93.1.1 (X:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} tlvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdn tggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgp kipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthl knsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdp kylsivkeyandqdkffkdfskafeklledgitfpkdapspfifktleeqgl
Timeline for d2rbvx_: