Lineage for d1ycbb_ (1ycb B:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 759576Protein Myoglobin [46469] (9 species)
  7. 759632Species Pig (Sus scrofa) [TaxId:9823] [46473] (17 PDB entries)
  8. 759660Domain d1ycbb_: 1ycb B: [15184]
    complexed with hem; mutant

Details for d1ycbb_

PDB Entry: 1ycb (more details), 2.1 Å

PDB Description: distal pocket polarity in ligand binding to myoglobin: deoxy and carbonmonoxy forms of a threonine68 (e11) mutant investigated by x-ray crystallography and infrared spectroscopy
PDB Compounds: (B:) Myoglobin

SCOP Domain Sequences for d1ycbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ycbb_ a.1.1.2 (B:) Myoglobin {Pig (Sus scrofa) [TaxId: 9823]}
glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
lkkhgnttltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamskalelfrndmaakykelgfqg

SCOP Domain Coordinates for d1ycbb_:

Click to download the PDB-style file with coordinates for d1ycbb_.
(The format of our PDB-style files is described here.)

Timeline for d1ycbb_: