Lineage for d2raxa1 (2rax A:7-117)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1967381Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 1967382Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 1967383Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 1967399Protein Anti-apoptotic protein survivin [57930] (2 species)
    contains a long alpha-helix after the common fold
  7. 1967400Species Human (Homo sapiens) [TaxId:9606] [57931] (9 PDB entries)
  8. 1967413Domain d2raxa1: 2rax A:7-117 [151835]
    automatically matched to d1xoxa1
    complexed with zn

Details for d2raxa1

PDB Entry: 2rax (more details), 3.3 Å

PDB Description: Crystal structure of Borealin (20-78) bound to Survivin (1-120)
PDB Compounds: (A:) Baculoviral IAP repeat-containing protein 5

SCOPe Domain Sequences for d2raxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2raxa1 g.52.1.1 (A:7-117) Anti-apoptotic protein survivin {Human (Homo sapiens) [TaxId: 9606]}
ppawqpflkdhristfknwpflegcactpermaeagfihcptenepdlaqcffcfkeleg
wepdddpieehkkhssgcaflsvkkqfeeltlgeflkldreraknkiaket

SCOPe Domain Coordinates for d2raxa1:

Click to download the PDB-style file with coordinates for d2raxa1.
(The format of our PDB-style files is described here.)

Timeline for d2raxa1: