Lineage for d2raxa1 (2rax A:7-117)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038051Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 3038052Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 3038053Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 3038069Protein Anti-apoptotic protein survivin [57930] (2 species)
    contains a long alpha-helix after the common fold
  7. 3038070Species Human (Homo sapiens) [TaxId:9606] [57931] (9 PDB entries)
  8. 3038083Domain d2raxa1: 2rax A:7-117 [151835]
    automatically matched to d1xoxa1
    complexed with zn
    has additional insertions and/or extensions that are not grouped together

Details for d2raxa1

PDB Entry: 2rax (more details), 3.3 Å

PDB Description: Crystal structure of Borealin (20-78) bound to Survivin (1-120)
PDB Compounds: (A:) Baculoviral IAP repeat-containing protein 5

SCOPe Domain Sequences for d2raxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2raxa1 g.52.1.1 (A:7-117) Anti-apoptotic protein survivin {Human (Homo sapiens) [TaxId: 9606]}
ppawqpflkdhristfknwpflegcactpermaeagfihcptenepdlaqcffcfkeleg
wepdddpieehkkhssgcaflsvkkqfeeltlgeflkldreraknkiaket

SCOPe Domain Coordinates for d2raxa1:

Click to download the PDB-style file with coordinates for d2raxa1.
(The format of our PDB-style files is described here.)

Timeline for d2raxa1: