SCOPe 2.07: Domain d2ralb2: 2ral B:425-595

Lineage for d2ralb2 (2ral B:425-595)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.4: Fibrinogen-binding domain [89210] (2 proteins)
   duplication: contains two differently decorated domains of this fold

6. Protein Fibrinogen-binding adhesin SdrG [101550] (1 species)

7. Species Staphylococcus epidermidis [TaxId:1282] [101551] (3 PDB entries)

8. Domain d2ralb2: 2ral B:425-595 [151826]
   automated match to d2rala2
   mutant

Details for d2ralb2

PDB Entry: 2ral, 2.8 Å

PDB Description: crystal structure analysis of double cysteine mutant of s.epidermidis adhesin sdrg: evidence for the dock,lock and latch ligand binding mechanism

PDB Compounds: (B:) Serine-aspartate repeat-containing protein G

SCOPe Domain Sequences for d2ralb2:

Sequence; same for both SEQRES and ATOM records:

>d2ralb2 b.2.3.4 (B:425-595) Fibrinogen-binding adhesin SdrG {Staphylococcus epidermidis [TaxId: 1282]}
qkpnenrtanlqsmftnidtknhtveqtiyinplrysaketnvnisgngdegstiiddst
iikvykvgdnqnlpdsnriydyseyedvtnddyaqlgnnndvninfgnidspyiikvisk
ydpnkddyttiqqtvtmqttineytgefrtasydntiafstssgqgqgdlc

Timeline for d2ralb2:

• d2ralb2 first appeared in SCOP 1.75
  
• d2ralb2 appears in SCOPe 2.06
  
• d2ralb2 appears in the current release, SCOPe 2.08