SCOPe 2.05: Domain d2r9ma_: 2r9m A:

Lineage for d2r9ma_ (2r9m A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein (Pro)cathepsin S [82566] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82567] (23 PDB entries)

8. Domain d2r9ma_: 2r9m A: [151792]
   automated match to d1ms6a_
   complexed with y11

Details for d2r9ma_

PDB Entry: 2r9m, 1.97 Å

PDB Description: cathepsin s complexed with compound 15

PDB Compounds: (A:) cathepsin S

SCOPe Domain Sequences for d2r9ma_:

Sequence; same for both SEQRES and ATOM records:

>d2r9ma_ d.3.1.1 (A:) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]}
lpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcstek
ygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpygr
edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw
lvknswghnfgeegyirmarnkgnhcgiasfpsypei

Timeline for d2r9ma_:

• d2r9ma_ first appeared in SCOP 1.75, called d2r9ma1
  
• d2r9ma_ appears in SCOPe 2.04
  
• d2r9ma_ appears in SCOPe 2.06
  
• d2r9ma_ appears in the current release, SCOPe 2.08