Lineage for d1myha_ (1myh A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 43952Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 43953Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 43963Family a.1.1.2: Globins [46463] (17 proteins)
  6. 44499Protein Myoglobin [46469] (9 species)
  7. 44523Species Pig (Sus scrofa) [TaxId:9823] [46473] (17 PDB entries)
  8. 44548Domain d1myha_: 1myh A: [15177]

Details for d1myha_

PDB Entry: 1myh (more details), 1.9 Å

PDB Description: high resolution x-ray structures of pig metmyoglobin and two cd3 mutants mb(lys45-> arg) and mb(lys45-> ser)

SCOP Domain Sequences for d1myha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1myha_ a.1.1.2 (A:) Myoglobin {Pig (Sus scrofa)}
glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdrfkhlksedemkased
lkkhgntvltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamskalelfrndmaakykelgfqg

SCOP Domain Coordinates for d1myha_:

Click to download the PDB-style file with coordinates for d1myha_.
(The format of our PDB-style files is described here.)

Timeline for d1myha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1myhb_