Lineage for d1myha_ (1myh A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687850Protein Myoglobin [46469] (11 species)
  7. 2687978Species Pig (Sus scrofa) [TaxId:9823] [46473] (17 PDB entries)
  8. 2688003Domain d1myha_: 1myh A: [15177]
    complexed with hem, so4; mutant

Details for d1myha_

PDB Entry: 1myh (more details), 1.9 Å

PDB Description: high resolution x-ray structures of pig metmyoglobin and two cd3 mutants mb(lys45-> arg) and mb(lys45-> ser)
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1myha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1myha_ a.1.1.2 (A:) Myoglobin {Pig (Sus scrofa) [TaxId: 9823]}
glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdrfkhlksedemkased
lkkhgntvltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamskalelfrndmaakykelgfqg

SCOPe Domain Coordinates for d1myha_:

Click to download the PDB-style file with coordinates for d1myha_.
(The format of our PDB-style files is described here.)

Timeline for d1myha_: