SCOPe 2.07: Domain d2r93f1: 2r93 F:72-155

Lineage for d2r93f1 (2r93 F:72-155)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
   core: 2 helices and adjacent loops

4. Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families)
   the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits

5. Family a.143.1.2: RPB6 [55294] (2 proteins)

6. Protein RPB6 [55295] (3 species)
   essential subunit of RNA polymerases I, II and III

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (31 PDB entries)
   Uniprot P20435; part of multichain biological unit

8. Domain d2r93f1: 2r93 F:72-155 [151757]
   Other proteins in same PDB: d2r93a1, d2r93b1, d2r93d1, d2r93g1, d2r93h1, d2r93j1, d2r93k1, d2r93l1
   automatically matched to d1i3qf_
   protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2r93f1

PDB Entry: 2r93, 4 Å

PDB Description: elongation complex of rna polymerase ii with a hepatitis delta virus- derived rna stem loop

PDB Compounds: (F:) DNA-directed RNA polymerases I, II, and III subunit RPABC2

SCOPe Domain Sequences for d2r93f1:

Sequence; same for both SEQRES and ATOM records:

>d2r93f1 a.143.1.2 (F:72-155) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivdl

Timeline for d2r93f1:

• d2r93f1 first appeared in SCOP 1.75
  
• d2r93f1 appears in SCOPe 2.06
  
• d2r93f1 appears in the current release, SCOPe 2.08