Lineage for d1myia_ (1myi A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 436026Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 436027Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 436063Family a.1.1.2: Globins [46463] (22 proteins)
    Heme-binding protein
  6. 436886Protein Myoglobin [46469] (9 species)
  7. 436917Species Pig (Sus scrofa) [TaxId:9823] [46473] (17 PDB entries)
  8. 436936Domain d1myia_: 1myi A: [15175]

Details for d1myia_

PDB Entry: 1myi (more details), 2 Å

PDB Description: high resolution x-ray structures of pig metmyoglobin and two cd3 mutants mb(lys45-> arg) and mb(lys45-> ser)

SCOP Domain Sequences for d1myia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1myia_ a.1.1.2 (A:) Myoglobin {Pig (Sus scrofa)}
glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdsfkhlksedemkased
lkkhgntvltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamskalelfrndmaakykelgfqg

SCOP Domain Coordinates for d1myia_:

Click to download the PDB-style file with coordinates for d1myia_.
(The format of our PDB-style files is described here.)

Timeline for d1myia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1myib_