SCOP 1.67: Domain d1myia_: 1myi A:

Lineage for d1myia_ (1myi A:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (20 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [46473] (17 PDB entries)

8. Domain d1myia_: 1myi A: [15175]

Details for d1myia_

PDB Entry: 1myi, 2 Å

PDB Description: high resolution x-ray structures of pig metmyoglobin and two cd3 mutants mb(lys45-> arg) and mb(lys45-> ser)

SCOP Domain Sequences for d1myia_:

Sequence; same for both SEQRES and ATOM records:

>d1myia_ a.1.1.2 (A:) Myoglobin {Pig (Sus scrofa)}
glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdsfkhlksedemkased
lkkhgntvltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamskalelfrndmaakykelgfqg

Timeline for d1myia_:

• d1myia_ first appeared (with stable ids) in SCOP 1.55
  
• d1myia_ appears in SCOP 1.65
  
• d1myia_ appears in SCOP 1.69
  
• d1myia_ appears in the current release, SCOPe 2.08