Lineage for d2r8ba1 (2r8b A:44-246)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900680Family c.69.1.14: Carboxylesterase/thioesterase 1 [53547] (5 proteins)
  6. 2900695Protein Uncharacterized protein Atu2452 [159740] (1 species)
  7. 2900696Species Agrobacterium tumefaciens [TaxId:358] [159741] (1 PDB entry)
    Uniprot A9CHT9 1-203
  8. 2900697Domain d2r8ba1: 2r8b A:44-246 [151696]
    complexed with so4

Details for d2r8ba1

PDB Entry: 2r8b (more details), 2.56 Å

PDB Description: The crystal structure of the protein Atu2452 of unknown function from Agrobacterium tumefaciens str. C58
PDB Compounds: (A:) Uncharacterized protein Atu2452

SCOPe Domain Sequences for d2r8ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]}
mtkdsyfhksragvagaplfvllhgtggdenqffdfgarllpqatilspvgdvsehgaar
ffrrtgegvydmvdleratgkmadfikanrehyqagpviglgfsnganilanvlieqpel
fdaavlmhplipfepkispakptrrvlitagerdpicpvqltkaleeslkaqggtvetvw
hpggheirsgeidavrgflaayg

SCOPe Domain Coordinates for d2r8ba1:

Click to download the PDB-style file with coordinates for d2r8ba1.
(The format of our PDB-style files is described here.)

Timeline for d2r8ba1: