PDB entry 2r8b

View 2r8b on RCSB PDB site
Description: The crystal structure of the protein Atu2452 of unknown function from Agrobacterium tumefaciens str. C58
Class: structural genomics, unknown function
Keywords: APC6088, protein Atu2452, Agrobacterium tumefaciens str. C58, structural genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2007-09-10, released 2007-09-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: 0.197
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein Atu2452
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: AGR_C_4453, Atu2452
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2r8ba1
  • Chain 'B':
    Compound: Uncharacterized protein Atu2452
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: AGR_C_4453, Atu2452
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2r8bb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r8bA (A:)
    ghmprpslrrgeetsgarslheiappaekavrkplnllpfrkdtpmtkdsyfhksragva
    gaplfvllhgtggdenqffdfgarllpqatilspvgdvsehgaarffrrtgegvydmvdl
    eratgkmadfikanrehyqagpviglgfsnganilanvlieqpelfdaavlmhplipfep
    kispakptrrvlitagerdpicpvqltkaleeslkaqggtvetvwhpggheirsgeidav
    rgflaaygggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8bA (A:)
    pmtkdsyfhksragvagaplfvllhgtggdenqffdfgarllpqatilspvgdvsehgaa
    rffrrtgegvydmvdleratgkmadfikanrehyqagpviglgfsnganilanvlieqpe
    lfdaavlmhplipfepkispakptrrvlitagerdpicpvqltkaleeslkaqggtvetv
    whpggheirsgeidavrgflaayg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2r8bB (B:)
    ghmprpslrrgeetsgarslheiappaekavrkplnllpfrkdtpmtkdsyfhksragva
    gaplfvllhgtggdenqffdfgarllpqatilspvgdvsehgaarffrrtgegvydmvdl
    eratgkmadfikanrehyqagpviglgfsnganilanvlieqpelfdaavlmhplipfep
    kispakptrrvlitagerdpicpvqltkaleeslkaqggtvetvwhpggheirsgeidav
    rgflaaygggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8bB (B:)
    pmtkdsyfhksragvagaplfvllhgtggdenqffdfgarllpqatilspvgdvsehgaa
    rffrrtgegvydmvdleratgkmadfikanrehyqagpviglgfsnganilanvlieqpe
    lfdaavlmhplipfepkispakptrrvlitagerdpicpvqltkaleeslkaqggtvetv
    whpggheirsgeidavrgflaayg