SCOPe 2.05: Domain d2r82a2: 2r82 A:377-509

Lineage for d2r82a2 (2r82 A:377-509)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.1: Phosphohistidine domain [52009] (2 families)
   contains barrel, closed, n=7, S=10

5. Family c.8.1.1: Pyruvate phosphate dikinase, central domain [52010] (1 protein)

6. Protein Pyruvate phosphate dikinase, central domain [52011] (3 species)

7. Species Clostridium symbiosum [TaxId:1512] [52012] (8 PDB entries)

8. Domain d2r82a2: 2r82 A:377-509 [151668]
   Other proteins in same PDB: d2r82a1, d2r82a3
   automatically matched to d1kbla2
   complexed with so4; mutant

Details for d2r82a2

PDB Entry: 2r82, 3.6 Å

PDB Description: pyruvate phosphate dikinase (ppdk) triple mutant r219e/e271r/s262d adapts a second conformational state

PDB Compounds: (A:) Pyruvate, phosphate dikinase

SCOPe Domain Sequences for d2r82a2:

Sequence; same for both SEQRES and ATOM records:

>d2r82a2 c.8.1.1 (A:377-509) Pyruvate phosphate dikinase, central domain {Clostridium symbiosum [TaxId: 1512]}
lhptfnpaalkagevigsalpaspgaaagkvyftadeakaahekgervilvrletspedi
egmhaaegiltvrggmtshaavvargmgtccvsgcgeikineeaktfelgghtfaegdyi
sldgstgkiykgd

Timeline for d2r82a2:

• d2r82a2 first appeared in SCOP 1.75
  
• d2r82a2 appears in SCOPe 2.04
  
• d2r82a2 appears in SCOPe 2.06
  
• d2r82a2 appears in the current release, SCOPe 2.08