| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.1: Phosphohistidine domain [52009] (3 families) ![]() contains barrel, closed, n=7, S=10 |
| Family c.8.1.1: Pyruvate phosphate dikinase, central domain [52010] (1 protein) |
| Protein Pyruvate phosphate dikinase, central domain [52011] (3 species) |
| Species Clostridium symbiosum [TaxId:1512] [52012] (8 PDB entries) |
| Domain d2r82a2: 2r82 A:377-509 [151668] Other proteins in same PDB: d2r82a1, d2r82a3 automatically matched to d1kbla2 complexed with so4; mutant |
PDB Entry: 2r82 (more details), 3.6 Å
SCOPe Domain Sequences for d2r82a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r82a2 c.8.1.1 (A:377-509) Pyruvate phosphate dikinase, central domain {Clostridium symbiosum [TaxId: 1512]}
lhptfnpaalkagevigsalpaspgaaagkvyftadeakaahekgervilvrletspedi
egmhaaegiltvrggmtshaavvargmgtccvsgcgeikineeaktfelgghtfaegdyi
sldgstgkiykgd
Timeline for d2r82a2: