Lineage for d2r7zd1 (2r7z D:4-221)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3044682Fold i.8: RNA polymerase [58180] (1 superfamily)
  4. 3044683Superfamily i.8.1: RNA polymerase [58181] (1 family) (S)
  5. 3044684Family i.8.1.1: RNA polymerase [58182] (2 proteins)
  6. 3044685Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species)
  7. 3044686Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (23 PDB entries)
  8. 3044740Domain d2r7zd1: 2r7z D:4-221 [151660]
    Other proteins in same PDB: d2r7zb1, d2r7zf1, d2r7zh1, d2r7zj1, d2r7zl1
    automatically matched to d1y1vd_
    protein/DNA complex; protein/RNA complex; complexed with cpt, mg, zn

Details for d2r7zd1

PDB Entry: 2r7z (more details), 3.8 Å

PDB Description: cisplatin lesion containing rna polymerase ii elongation complex
PDB Compounds: (D:) DNA-directed RNA polymerase II subunit RPB4

SCOPe Domain Sequences for d2r7zd1:

Sequence, based on SEQRES records: (download)

>d2r7zd1 i.8.1.1 (D:4-221) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ststfqtrrrrlkkveeeenaatlqlgqefqlkqinhqgeeeelialnlsearlvikeal
verrrafkrsqkkhkkkhlkhenandettavededddldeddvnaddddfmhsetrekel
esidvlleqttggnnkdlkntmqyltnfsrfrdqetvgaviqllkstglhpfevaqlgsl
acdtadeaktlipslnnkisddelerilkelsnletly

Sequence, based on observed residues (ATOM records): (download)

>d2r7zd1 i.8.1.1 (D:4-221) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ststfqtrrrrlkkveeeenaatlqlgqefqlkqinhqgeeeelialnlsearlvikeal
verrrafkrsqkktrekelesidvlleqttggnnkdlkntmqyltnfsrfrdqetvgavi
qllkstglhpfevaqlgslacdtadeaktlipslnnkisddelerilkelsnletly

SCOPe Domain Coordinates for d2r7zd1:

Click to download the PDB-style file with coordinates for d2r7zd1.
(The format of our PDB-style files is described here.)

Timeline for d2r7zd1: