SCOPe 2.08: Domain d2r61a1: 2r61 A:8-100

Lineage for d2r61a1 (2r61 A:8-100)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)

6. Protein Superantigen-like protein SET3 [74946] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [74947] (3 PDB entries)

8. Domain d2r61a1: 2r61 A:8-100 [151599]
   Other proteins in same PDB: d2r61a2
   automated match to d1m4va1
   complexed with cl, gol, srt

Details for d2r61a1

PDB Entry: 2r61, 2.75 Å

PDB Description: crystal structure of the staphylococcal superantigen-like protein ssl5 in complex with sialyl-lewis x at ph 7.4

PDB Compounds: (A:) Exotoxin 3

SCOPe Domain Sequences for d2r61a1:

Sequence, based on SEQRES records:

>d2r61a1 b.40.2.2 (A:8-100) Superantigen-like protein SET3 {Staphylococcus aureus [TaxId: 1280]}
envtkdifdlrdyysgaskelknvtgyryskggkhylifdahqaftriqifgkdierlka
rknpgldifvvkeaenrngtvfsyggvtkknqg

Sequence, based on observed residues (ATOM records):

>d2r61a1 b.40.2.2 (A:8-100) Superantigen-like protein SET3 {Staphylococcus aureus [TaxId: 1280]}
envtkdifdlrdyysgaskelknvtgyryskggkhylifdahqaftriqifgkdierlka
rknpgldifvvkeaenrtvfsyggvtkknqg

Timeline for d2r61a1:

• d2r61a1 first appeared in SCOP 1.75
  
• d2r61a1 appears in SCOPe 2.07