PDB entry 2r61

View 2r61 on RCSB PDB site
Description: Crystal structure of the Staphylococcal superantigen-like protein SSL5 in complex with sialyl-Lewis X at pH 7.4
Class: sugar binding protein
Keywords: SSL5, superantigen-like, sialyl Lewis X, sialic acid binding, CHIPS, SUGAR BINDING PROTEIN
Deposited on 2007-09-05, released 2007-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.212
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Exotoxin 3
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: ssl5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZFS6 (Start-207)
      • see remark 999 (26)
      • see remark 999 (51-54)
      • see remark 999 (68)
      • see remark 999 (70)
      • see remark 999 (92)
      • see remark 999 (110)
      • see remark 999 (113)
      • see remark 999 (121)
      • see remark 999 (125-126)
      • see remark 999 (131)
      • see remark 999 (138)
      • see remark 999 (154)
      • see remark 999 (164)
      • see remark 999 (170)
      • see remark 999 (187-188)
      • see remark 999 (202)
    Domains in SCOPe 2.07: d2r61a1, d2r61a2
  • Heterogens: CL, SRT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r61A (A:)
    gpgssehkakyenvtkdifdlrdyysgaskelknvtgyryskggkhylifdahqaftriq
    ifgkdierlkarknpgldifvvkeaenrngtvfsyggvtkknqgayydylnapkfvikke
    vdagvythvkrhyiykeevslkeldfklrqyliqnfdlykkfpkdskikvimkdggyytf
    elnkklqphrmsdvidgrniekmeanir
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r61A (A:)
    envtkdifdlrdyysgaskelknvtgyryskggkhylifdahqaftriqifgkdierlka
    rknpgldifvvkeaenrtvfsyggvtkknqgayydylnapkfvikkevdagvythvkrhy
    iykeevslkeldfklrqyliqnfdlykkfpkdskikvimkdggyytfelnkklqphrmsd
    vidgrniekmeanir