SCOPe 2.05: Domain d2r5eb_: 2r5e B:

Lineage for d2r5eb_ (2r5e B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.1: AAT-like [53384] (17 proteins)

6. Protein Kynurenine--oxoglutarate transaminase I [110681] (2 species)

7. Species Yellow fever mosquito (Aedes aegypti) [TaxId:7159] [142654] (3 PDB entries)
   Uniprot Q95VY4 61-477

8. Domain d2r5eb_: 2r5e B: [151589]
   automated match to d1yiya1
   complexed with qlp

Details for d2r5eb_

PDB Entry: 2r5e, 1.84 Å

PDB Description: Aedes kynurenine aminotransferase in complex with glutamine

PDB Compounds: (B:) Kynurenine aminotransferase

SCOPe Domain Sequences for d2r5eb_:

Sequence; same for both SEQRES and ATOM records:

>d2r5eb_ c.67.1.1 (B:) Kynurenine--oxoglutarate transaminase I {Yellow fever mosquito (Aedes aegypti) [TaxId: 7159]}
nkfdlpkryqgstksvwveyiqlaaqykplnlgqgfpdyhapkyalnalaaaanspdpla
nqytrgfghprlvqalsklysqlvdrtinpmtevlvtvgayealyatiqghvdegdevii
iepffdcyepmvkaaggiprfiplkpnktggtissadwvldnnelealfnektkmiiint
phnplgkvmdraelevvanlckkwnvlcvsdevyehmvfepfehirictlpgmwertiti
gsagktfsltgwkigwaygpeallknlqmvhqncvytcatpiqeaiavgfetelkrlksp
ecyfnsisgelmakrdymasflaevgmnptvpqggyfmvadwssldskvdltqetdarkd
yrftkwmtksvglqgippsafysepnkhlgedfvrycffkkdenlqkaaeilrkwkgss

Timeline for d2r5eb_:

• d2r5eb_ first appeared in SCOP 1.75, called d2r5eb1
  
• d2r5eb_ appears in SCOPe 2.04
  
• d2r5eb_ appears in SCOPe 2.06
  
• d2r5eb_ appears in the current release, SCOPe 2.08