Lineage for d2r5eb1 (2r5e B:12-429)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 840449Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 840450Superfamily c.67.1: PLP-dependent transferases [53383] (9 families) (S)
  5. 840451Family c.67.1.1: AAT-like [53384] (16 proteins)
  6. 840707Protein Kynurenine--oxoglutarate transaminase I [110681] (2 species)
  7. 840712Species Yellowfever mosquito (Aedes aegypti) [TaxId:7159] [142654] (4 PDB entries)
    Uniprot Q95VY4 61-477
  8. 840714Domain d2r5eb1: 2r5e B:12-429 [151589]
    automatically matched to d1yiya1
    complexed with qlp

Details for d2r5eb1

PDB Entry: 2r5e (more details), 1.84 Å

PDB Description: Aedes kynurenine aminotransferase in complex with glutamine
PDB Compounds: (B:) Kynurenine aminotransferase

SCOP Domain Sequences for d2r5eb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r5eb1 c.67.1.1 (B:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]}
kfdlpkryqgstksvwveyiqlaaqykplnlgqgfpdyhapkyalnalaaaanspdplan
qytrgfghprlvqalsklysqlvdrtinpmtevlvtvgayealyatiqghvdegdeviii
epffdcyepmvkaaggiprfiplkpnktggtissadwvldnnelealfnektkmiiintp
hnplgkvmdraelevvanlckkwnvlcvsdevyehmvfepfehirictlpgmwertitig
sagktfsltgwkigwaygpeallknlqmvhqncvytcatpiqeaiavgfetelkrlkspe
cyfnsisgelmakrdymasflaevgmnptvpqggyfmvadwssldskvdltqetdarkdy
rftkwmtksvglqgippsafysepnkhlgedfvrycffkkdenlqkaaeilrkwkgss

SCOP Domain Coordinates for d2r5eb1:

Click to download the PDB-style file with coordinates for d2r5eb1.
(The format of our PDB-style files is described here.)

Timeline for d2r5eb1: