Lineage for d2r31a2 (2r31 A:4-238)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011800Fold d.381: ATP12-like [160908] (1 superfamily)
    contains an N-terminal beta-sheet that forms a beta-triangle structure; the remainder is a multihelical array of long and short helices
  4. 3011801Superfamily d.381.1: ATP12-like [160909] (1 family) (S)
  5. 3011802Family d.381.1.1: ATP12-like [160910] (2 proteins)
    Pfam PF07542; F1-ATPase chaperone
  6. 3011803Protein ATP12 ATPase [160913] (1 species)
  7. 3011804Species Paracoccus denitrificans [TaxId:266] [160914] (3 PDB entries)
    Uniprot A1B060 2-235! Uniprot A1B060 3-235
  8. 3011805Domain d2r31a2: 2r31 A:4-238 [151546]
    Other proteins in same PDB: d2r31a3
    automated match to d2zd2a1
    complexed with trs

Details for d2r31a2

PDB Entry: 2r31 (more details), 1 Å

PDB Description: crystal structure of atp12p from paracoccus denitrificans
PDB Compounds: (A:) ATP12 ATPase

SCOPe Domain Sequences for d2r31a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r31a2 d.381.1.1 (A:4-238) ATP12 ATPase {Paracoccus denitrificans [TaxId: 266]}
msewkarrfwasvgihkeeggwavllderplrtpgkqplrlptealalaiaeewqavqev
idpnampltrsansaiekvapqfdavaamlgdyggtdllsyradapealvraqaegwdpl
idwaatelraplrithgvipvpqdpvvllklraevasldpfgltalhdlvtlpgslilgl
avirgridaptahalsrideefqaerwgrdeeaeaqaasrlaamrdserfwhltr

SCOPe Domain Coordinates for d2r31a2:

Click to download the PDB-style file with coordinates for d2r31a2.
(The format of our PDB-style files is described here.)

Timeline for d2r31a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r31a3