Lineage for d2zd2a1 (2zd2 A:1005-1238)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.381: ATP12-like [160908] (1 superfamily)
contains an N-terminal beta-sheet that forms a beta-triangle structure; the remainder is a multihelical array of long and short helicesSuperfamily d.381.1: ATP12-like [160909] (1 family) 
Family d.381.1.1: ATP12-like [160910] (2 proteins)
Pfam PF07542; F1-ATPase chaperoneProtein ATP12 ATPase [160913] (1 species) Species Paracoccus denitrificans [TaxId:266] [160914] (3 PDB entries)
Uniprot A1B060 2-235! Uniprot A1B060 3-235
Domain d2zd2a1: 2zd2 A:1005-1238 [154389]
mutant
Details for d2zd2a1
PDB Entry: 2zd2 (more details), 1.8 Å
PDB Description: d202k mutant of p. denitrificans atp12p
PDB Compounds: (A:) ATP12 ATPaseSCOPe Domain Sequences for d2zd2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zd2a1 d.381.1.1 (A:1005-1238) ATP12 ATPase {Paracoccus denitrificans [TaxId: 266]}
sewkarrfwasvgihkeeggwavllderplrtpgkqplrlptealalaiaeewqavqevi
dpnampltrsansaiekvapqfdavaamlgdyggtdllsyradapealvraqaegwdpli
dwaatelraplrithgvipvpqdpvvllklraevasldpfgltalhdlvtlpgslilgla
virgridaptahalsrikeefqaerwgrdeeaeaqaasrlaamrdserfwhltr
SCOPe Domain Coordinates for d2zd2a1:
Click to download the PDB-style file with coordinates for d2zd2a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2zd2a1:
- d2zd2a1 first appeared in SCOP 1.75
- d2zd2a1 appears in SCOPe 2.07
View in 3D
