Class g: Small proteins [56992] (91 folds) |
Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) |
Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins) Pfam PF00084 |
Protein Complement decay-accelerating factor (Daf, CD55) [90172] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [90173] (18 PDB entries) |
Domain d2qzha1: 2qzh A:1061-1127 [151486] automatically matched to d1nwva1 |
PDB Entry: 2qzh (more details), 14 Å
SCOPe Domain Sequences for d2qzha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qzha1 g.18.1.1 (A:1061-1127) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} frscevptrlnsaslkqpyitqnyfpvgtvveyecrpgyrrepslspkltclqnlkwsta vefckkk
Timeline for d2qzha1: