Lineage for d2qzha1 (2qzh A:1061-1127)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1703717Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 1703718Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 1703719Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. 1703814Protein Complement decay-accelerating factor (Daf, CD55) [90172] (1 species)
  7. 1703815Species Human (Homo sapiens) [TaxId:9606] [90173] (18 PDB entries)
  8. 1703902Domain d2qzha1: 2qzh A:1061-1127 [151486]
    automatically matched to d1nwva1

Details for d2qzha1

PDB Entry: 2qzh (more details), 14 Å

PDB Description: scr2/3 of daf from the nmr structure 1nwv fitted into a cryoem reconstruction of cvb3-rd complexed with daf
PDB Compounds: (A:) complement decay-accelerating factor

SCOPe Domain Sequences for d2qzha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qzha1 g.18.1.1 (A:1061-1127) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]}
frscevptrlnsaslkqpyitqnyfpvgtvveyecrpgyrrepslspkltclqnlkwsta
vefckkk

SCOPe Domain Coordinates for d2qzha1:

Click to download the PDB-style file with coordinates for d2qzha1.
(The format of our PDB-style files is described here.)

Timeline for d2qzha1: