Lineage for d2qynb1 (2qyn B:88-411)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 780219Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 780220Superfamily a.211.1: HD-domain/PDEase-like [109604] (5 families) (S)
  5. 780284Family a.211.1.2: PDEase [48548] (6 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 780317Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)
  7. 780318Species Human (Homo sapiens) [TaxId:9606] [89152] (22 PDB entries)
    Uniprot Q08499 388-713
  8. 780338Domain d2qynb1: 2qyn B:88-411 [151476]
    automatically matched to d1oyna_
    complexed with mg, npv, zn

Details for d2qynb1

PDB Entry: 2qyn (more details), 1.57 Å

PDB Description: Crystal structure of PDE4D2 in complex with inhibitor NPV
PDB Compounds: (B:) cAMP-specific 3',5'-cyclic phosphodiesterase 4D

SCOP Domain Sequences for d2qynb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qynb1 a.211.1.2 (B:88-411) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
qedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlitylm
tledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpgv
snqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvidi
vlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkplq
lyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwadl
vhpdaqdildtlednrewyqstip

SCOP Domain Coordinates for d2qynb1:

Click to download the PDB-style file with coordinates for d2qynb1.
(The format of our PDB-style files is described here.)

Timeline for d2qynb1: