SCOPe 2.03: Domain d2qy9a2: 2qy9 A:285-495

Lineage for d2qy9a2 (2qy9 A:285-495)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein GTPase domain of the signal recognition particle receptor FtsY [52666] (3 species)

7. Species Escherichia coli [TaxId:562] [52667] (2 PDB entries)

8. Domain d2qy9a2: 2qy9 A:285-495 [151470]
   Other proteins in same PDB: d2qy9a1
   automatically matched to d1ftsa2

Details for d2qy9a2

PDB Entry: 2qy9, 1.9 Å

PDB Description: Structure of the NG+1 construct of the E. coli SRP receptor FtsY

PDB Compounds: (A:) cell division protein ftsy

SCOPe Domain Sequences for d2qy9a2:

Sequence; same for both SEQRES and ATOM records:

>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]}
plnvegkapfvilmvgvngvgktttigklarqfeqqgksvmlaagdtfraaaveqlqvwg
qrnnipviaqhtgadsasvifdaiqaakarnidvliadtagrlqnkshlmeelkkivrvm
kkldveaphevmltidastgqnavsqaklfheavgltgitltkldgtakggvifsvadqf
gipiryigvgeriedlrpfkaddfiealfar

Timeline for d2qy9a2:

• d2qy9a2 first appeared in SCOP 1.75
  
• d2qy9a2 appears in SCOPe 2.02
  
• d2qy9a2 appears in SCOPe 2.04
  
• d2qy9a2 appears in the current release, SCOPe 2.08